PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462912049
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family B3
Protein Properties Length: 407aa    MW: 46174.4 Da    PI: 10.0023
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462912049genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3551.4e-1738125194
                EEEE-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
         B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                ffk++ p+ +++  +l +p +f  e+ +++++  + ++l+ +sg+ W+vkl    +s+++ +t GWk+Fv ++ L+++  +vF++dg sef+ vv
  462912049  38 FFKIFFPEQSGE--CLKIPPPFH-EYlEKEPN--RLISLKGPSGNIWKVKL--ASGSKGHAFTHGWKGFVGDHSLEQNHLLVFTYDGCSEFSVVV 125
                788887766665..49******9.66365544..58***************..********************************9988886555 PP

2B355.11.4e-173053891098
                HHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
         B3  10 vlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                v +   + +p +f++e    +++sk++tl d++g+sW+v+++y ++++   +t+GW +F+  n+L+  D++vF+l ++++   +v+++r
  462912049 305 VYEAFFMNIPCEFVKESL--PQTSKKMTLWDPQGKSWDVNYQYYNGRCVAAFTGGWGQFALGNNLEKFDVCVFELLKEDSI--KVHIYR 389
                56667789******8874..347889************************************************9876555..777766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.5E-2135130IPR015300DNA-binding pseudobarrel domain
CDDcd100172.20E-1436127No hitNo description
SuperFamilySSF1019361.03E-2037133IPR015300DNA-binding pseudobarrel domain
PfamPF023626.3E-1538125IPR003340B3 DNA binding domain
SMARTSM010191.5E-1438130IPR003340B3 DNA binding domain
PROSITE profilePS5086312.33751129IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.7E-26288389IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.83E-24289389IPR015300DNA-binding pseudobarrel domain
CDDcd100174.93E-22294389No hitNo description
PROSITE profilePS5086313.225296391IPR003340B3 DNA binding domain
SMARTSM010197.3E-14296391IPR003340B3 DNA binding domain
PfamPF023621.0E-15300389IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MGKMGIEGRK DEGKEAKKEK TQRGAAKDGD STGAGKHFFK IFFPEQSGEC LKIPPPFHEY  60
LEKEPNRLIS LKGPSGNIWK VKLASGSKGH AFTHGWKGFV GDHSLEQNHL LVFTYDGCSE  120
FSVVVLCPSG VDDKLAFCAQ PCKEIFVKAE VERWVVNSKA AGTSKMELPG LPSVEDNGKI  180
RKRVRQMTDI MINGSALKKR ISAQKKQEKR KPEAISSPSK PVPTFILNSK KDFPYLLDES  240
SCSRKTQIRP KDVPRSVKSK KFRLPVVISQ RRPITEEEKD HALKRANEFK SKNPFTLQVM  300
TKCCVYEAFF MNIPCEFVKE SLPQTSKKMT LWDPQGKSWD VNYQYYNGRC VAAFTGGWGQ  360
FALGNNLEKF DVCVFELLKE DSIKVHIYRV VSEITLLMRY SSMYRKT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A2e-1326939022142B3 domain-containing transcription factor VRN
4i1k_B2e-1326939022142B3 domain-containing transcription factor VRN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1178184KIRKRVR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978926.11e-139PREDICTED: B3 domain-containing protein Os11g0197600-like
TrEMBLA0A0A9DCS31e-154A0A0A9DCS3_ARUDO; Uncharacterized protein
STRINGSi027380m1e-129(Setaria italica)
STRINGSb05g006090.11e-129(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44613766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.19e-20B3 family protein